3.93 Rating by CuteStat

kaushalmanda.com is 5 years 8 months old. It is a domain having com extension. It has a global traffic rank of #2966503 in the world. This website is estimated worth of $ 480.00 and have a daily income of around $ 2.00. As no active threats were reported recently by users, kaushalmanda.com is SAFE to browse.

PageSpeed Score
57
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 284
Daily Pageviews: 568

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: 39
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 37,900
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 2,966,503
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011
.:: Kaushal Manda ::.

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 3
H3 Headings: 1 H4 Headings: 4
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 7
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 27 Dec 2019 03:06:38 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Length: 15510
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Aug 11, 2018, 1:42 PM 5 years 8 months 3 weeks ago
Expiration Date: Aug 11, 2020, 1:42 PM 3 years 8 months 2 weeks ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
kaushalmanda.com A 10798 IP: 103.24.200.143
kaushalmanda.com NS 86400 Target: ns1.lazybulls.com
kaushalmanda.com NS 86400 Target: ns2.lazybulls.com
kaushalmanda.com SOA 10800 MNAME: ns1.lazybulls.com
RNAME: root.i-h1-cs-r04-i0117-141.webazilla.com
Serial: 2019061705
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
kaushalmanda.com MX 14400 Priority: 5
Target: alt1.aspmx.l.google.com
kaushalmanda.com MX 14400 Priority: 5
Target: alt2.aspmx.l.google.com
kaushalmanda.com MX 14400 Priority: 10
Target: alt3.aspmx.l.google.com
kaushalmanda.com MX 14400 Priority: 10
Target: alt4.aspmx.l.google.com
kaushalmanda.com MX 14400 Priority: 1
Target: aspmx.l.google.com
kaushalmanda.com TXT 14400 TXT: v=spf1 ip4:103.24.200.143
ip4:103.24.200.141 +a +mx ~all

Similarly Ranked Websites

High Amp Output Heavy Duty High Efficiency Alternators.

- americanpowerinc.com

APS American Power Systems High Output High Efficiency, Heavy Duty Altenator and Armored Vehicle Power Custom Design.

2,966,505 $ 240.00

גולר1 - עולם הכדורגל הישראלי | ליגה לאומית | ליגות נמוכות

- goler1.co.il

"גולר-עולם הכדורגל הישראלי,סיקורים ממשחקי הליגה הלאומית,ליגות נמוכות א,ב,ג והליגה הלאומית לנוער כולל תוצאות און ליין מהמגרשים"

2,966,510 $ 480.00

StarQuest Info Center

- docs.starquest.com
2,966,510 $ 480.00

Leading Design Build Firm | The Austin Company

- theaustin.com

The Austin Company is a leading design-build firm with thousands of projects completed across the globe. Contact us today to learn about our consulting, design and engineering capabilities.

2,966,512 $ 480.00

MP Toner - renovace tonerů

- m.mptoner.cz

Profesionální renovace inkoustových a tonerových cartridgí do tiskáren. Dodáme kompatibilní tonery, papír, kancelářské potřeby, tiskárny, řezačky, skartovací stroje.

2,966,512 $ 480.00

Full WHOIS Lookup

Domain Name: kaushalmanda.com
Registry Domain ID: 2296154777_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-10-29T04:34:21Z
Creation Date: 2018-08-11T07:57:02Z
Registrar Registration Expiration Date: 2020-08-11T07:57:02Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: kaushalmanda.com@domainsbyproxy.com
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: kaushalmanda.com@domainsbyproxy.com
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: kaushalmanda.com@domainsbyproxy.com
Name Server: NS1.LAZYBULLS.COM
Name Server: NS2.LAZYBULLS.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-27T03:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.